Lineage for d2jg3a2 (2jg3 A:244-414)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009817Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 3009818Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 3009819Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)
  6. 3009842Protein automated matches [254552] (1 species)
    not a true protein
  7. 3009843Species Thermus aquaticus [TaxId:271] [255261] (1 PDB entry)
  8. 3009844Domain d2jg3a2: 2jg3 A:244-414 [148036]
    Other proteins in same PDB: d2jg3a1, d2jg3d1
    automated match to d2adma2
    protein/DNA complex; complexed with ba2, gol, k

Details for d2jg3a2

PDB Entry: 2jg3 (more details), 1.9 Å

PDB Description: mtaqi with baz
PDB Compounds: (A:) modification methylase taqi

SCOPe Domain Sequences for d2jg3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg3a2 d.287.1.1 (A:244-414) automated matches {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfhts

SCOPe Domain Coordinates for d2jg3a2:

Click to download the PDB-style file with coordinates for d2jg3a2.
(The format of our PDB-style files is described here.)

Timeline for d2jg3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jg3a1