Lineage for d2jg3d1 (2jg3 D:23-243)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893784Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (2 proteins)
  6. Protein automated matches [254551] (1 species)
    not a true protein
  7. Species Thermus aquaticus [TaxId:271] [255260] (1 PDB entry)
  8. 2893810Domain d2jg3d1: 2jg3 D:23-243 [148037]
    Other proteins in same PDB: d2jg3a2, d2jg3d2
    automated match to d1g38a1
    protein/DNA complex; complexed with ba2, gol, k

Details for d2jg3d1

PDB Entry: 2jg3 (more details), 1.9 Å

PDB Description: mtaqi with baz
PDB Compounds: (D:) modification methylase taqi

SCOPe Domain Sequences for d2jg3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jg3d1 c.66.1.27 (D:23-243) automated matches {Thermus aquaticus [TaxId: 271]}
tppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlppw
aegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgkynl
ygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkkvs
avvirfqksgkglslwdtqesesgftpilwaeyphwegeii

SCOPe Domain Coordinates for d2jg3d1:

Click to download the PDB-style file with coordinates for d2jg3d1.
(The format of our PDB-style files is described here.)

Timeline for d2jg3d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2jg3d2