Lineage for d2j4rb1 (2j4r B:7-132)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171806Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein)
    Pfam PF02541
  6. 1171807Protein Exopolyphosphatase Ppx [110631] (2 species)
  7. 1171808Species Aquifex aeolicus [TaxId:63363] [110632] (3 PDB entries)
    Uniprot O67040
  8. 1171817Domain d2j4rb1: 2j4r B:7-132 [147884]
    automatically matched to d1t6ca1
    complexed with g4p

Details for d2j4rb1

PDB Entry: 2j4r (more details), 2.71 Å

PDB Description: structural study of the aquifex aeolicus ppx-gppa enzyme
PDB Compounds: (B:) exopolyphosphatase

SCOPe Domain Sequences for d2j4rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4rb1 c.55.1.8 (B:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}
pimrvasidigsnsvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv
lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla
vayslk

SCOPe Domain Coordinates for d2j4rb1:

Click to download the PDB-style file with coordinates for d2j4rb1.
(The format of our PDB-style files is described here.)

Timeline for d2j4rb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j4rb2