![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein) Pfam PF02541 |
![]() | Protein Exopolyphosphatase Ppx [110631] (2 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [110632] (3 PDB entries) Uniprot O67040 |
![]() | Domain d2j4rb1: 2j4r B:7-132 [147884] automatically matched to d1t6ca1 complexed with g4p |
PDB Entry: 2j4r (more details), 2.71 Å
SCOPe Domain Sequences for d2j4rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j4rb1 c.55.1.8 (B:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} pimrvasidigsnsvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla vayslk
Timeline for d2j4rb1: