SCOPe 2.08: Domain d2j4rb1: 2j4r B:7-132

Lineage for d2j4rb1 (2j4r B:7-132)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins)
   Pfam PF02541

6. Protein automated matches [254546] (1 species)
   not a true protein
7. Species Aquifex aeolicus [TaxId:63363] [255249] (1 PDB entry)

8. Domain d2j4rb1: 2j4r B:7-132 [147884]
   automated match to d1t6ca1
   complexed with g4p

Details for d2j4rb1

PDB Entry: 2j4r, 2.71 Å

PDB Description: structural study of the aquifex aeolicus ppx-gppa enzyme

PDB Compounds: (B:) exopolyphosphatase

SCOPe Domain Sequences for d2j4rb1:

Sequence; same for both SEQRES and ATOM records:

>d2j4rb1 c.55.1.8 (B:7-132) automated matches {Aquifex aeolicus [TaxId: 63363]}
pimrvasidigsnsvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqv
lkeykklidefkvervkavateairraknaeeflervkrevglvvevitpeqegryayla
vayslk

Timeline for d2j4rb1:

• d2j4rb1 first appeared in SCOP 1.75
  
• d2j4rb1 appears in SCOPe 2.07