SCOPe 2.06: Domain d2j4bc_: 2j4b C:

Lineage for d2j4bc_ (2j4b C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily)
   multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon

4. Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family)
   automatically mapped to Pfam PF04494

5. Family d.379.1.1: Taf5 N-terminal domain-like [160898] (2 proteins)
   Pfam PF04494

6. Protein automated matches [190727] (1 species)
   not a true protein

7. Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [187892] (1 PDB entry)

8. Domain d2j4bc_: 2j4b C: [147873]
   Other proteins in same PDB: d2j4ba1
   automated match to d2j4ba1

Details for d2j4bc_

PDB Entry: 2j4b, 2.5 Å

PDB Description: crystal structure of encephalitozoon cuniculi taf5 n-terminal domain

PDB Compounds: (C:) transcription initiation factor tfiid subunit 72/90-100 kda

SCOPe Domain Sequences for d2j4bc_:

Sequence; same for both SEQRES and ATOM records:

>d2j4bc_ d.379.1.1 (C:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
kdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgd
hynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilk
ilnqhldikvyvg

Timeline for d2j4bc_:

• d2j4bc_ first appeared in SCOP 1.75, called d2j4bc1
  
• d2j4bc_ appears in SCOPe 2.05
  
• d2j4bc_ appears in SCOPe 2.07
  
• d2j4bc_ appears in the current release, SCOPe 2.08