Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily) multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon |
Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) automatically mapped to Pfam PF04494 |
Family d.379.1.1: Taf5 N-terminal domain-like [160898] (2 proteins) Pfam PF04494 |
Protein automated matches [190727] (1 species) not a true protein |
Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [187892] (1 PDB entry) |
Domain d2j4bc_: 2j4b C: [147873] Other proteins in same PDB: d2j4ba1 automated match to d2j4ba1 |
PDB Entry: 2j4b (more details), 2.5 Å
SCOPe Domain Sequences for d2j4bc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j4bc_ d.379.1.1 (C:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} kdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgd hynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilk ilnqhldikvyvg
Timeline for d2j4bc_:
View in 3D Domains from other chains: (mouse over for more information) d2j4ba1, d2j4bb_, d2j4bd_, d2j4be_ |