Lineage for d2j4bc1 (2j4b C:18-148)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 883121Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily)
    multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon
  4. 883122Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) (S)
  5. 883123Family d.379.1.1: Taf5 N-terminal domain-like [160898] (1 protein)
    Pfam PF04494
  6. 883124Protein TAF5 subunit of TFIID [160899] (3 species)
  7. 883125Species Encephalitozoon cuniculi [TaxId:6035] [160902] (1 PDB entry)
    Uniprot Q8SQS4 18-148
  8. 883128Domain d2j4bc1: 2j4b C:18-148 [147873]
    automatically matched to 2J4B A:18-148

Details for d2j4bc1

PDB Entry: 2j4b (more details), 2.5 Å

PDB Description: crystal structure of encephalitozoon cuniculi taf5 n-terminal domain
PDB Compounds: (C:) transcription initiation factor tfiid subunit 72/90-100 kda

SCOP Domain Sequences for d2j4bc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4bc1 d.379.1.1 (C:18-148) TAF5 subunit of TFIID {Encephalitozoon cuniculi [TaxId: 6035]}
qmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgdhy
nkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilkil
nqhldikvyvg

SCOP Domain Coordinates for d2j4bc1:

Click to download the PDB-style file with coordinates for d2j4bc1.
(The format of our PDB-style files is described here.)

Timeline for d2j4bc1: