Lineage for d2j4bc_ (2j4b C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011770Fold d.379: Taf5 N-terminal domain-like [160896] (1 superfamily)
    multihelical cluster with a C-terminal beta-alpha(2)-beta motif; one central buried helix; parallel beta-ribbon
  4. 3011771Superfamily d.379.1: Taf5 N-terminal domain-like [160897] (1 family) (S)
    automatically mapped to Pfam PF04494
  5. 3011772Family d.379.1.1: Taf5 N-terminal domain-like [160898] (2 proteins)
    Pfam PF04494
  6. 3011787Protein automated matches [190727] (1 species)
    not a true protein
  7. 3011788Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [187892] (1 PDB entry)
  8. 3011790Domain d2j4bc_: 2j4b C: [147873]
    Other proteins in same PDB: d2j4ba1
    automated match to d2j4ba1

Details for d2j4bc_

PDB Entry: 2j4b (more details), 2.5 Å

PDB Description: crystal structure of encephalitozoon cuniculi taf5 n-terminal domain
PDB Compounds: (C:) transcription initiation factor tfiid subunit 72/90-100 kda

SCOPe Domain Sequences for d2j4bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j4bc_ d.379.1.1 (C:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
kdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgd
hynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilk
ilnqhldikvyvg

SCOPe Domain Coordinates for d2j4bc_:

Click to download the PDB-style file with coordinates for d2j4bc_.
(The format of our PDB-style files is described here.)

Timeline for d2j4bc_: