Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (6 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [254875] (2 PDB entries) |
Domain d2j0ma2: 2j0m A:254-359 [147846] Other proteins in same PDB: d2j0ma1, d2j0ma3, d2j0mb_ automated match to d2al6a2 complexed with 4st |
PDB Entry: 2j0m (more details), 2.8 Å
SCOPe Domain Sequences for d2j0ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0ma2 b.55.1.0 (A:254-359) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfi
Timeline for d2j0ma2: