Lineage for d2j0ma2 (2j0m A:254-359)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805516Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 805526Protein Focal adhesion kinase 1 [141432] (1 species)
  7. 805527Species Chicken (Gallus gallus) [TaxId:9031] [141433] (3 PDB entries)
    Uniprot Q00944 254-363
  8. 805532Domain d2j0ma2: 2j0m A:254-359 [147846]
    Other proteins in same PDB: d2j0ma1, d2j0ma3
    automatically matched to d2aeha2
    complexed with 4st

Details for d2j0ma2

PDB Entry: 2j0m (more details), 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOP Domain Sequences for d2j0ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ma2 b.55.1.5 (A:254-359) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfi

SCOP Domain Coordinates for d2j0ma2:

Click to download the PDB-style file with coordinates for d2j0ma2.
(The format of our PDB-style files is described here.)

Timeline for d2j0ma2: