Lineage for d2j0ma2 (2j0m A:254-359)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799445Species Chicken (Gallus gallus) [TaxId:9031] [254875] (2 PDB entries)
  8. 1799446Domain d2j0ma2: 2j0m A:254-359 [147846]
    Other proteins in same PDB: d2j0ma1, d2j0ma3, d2j0mb_
    automated match to d2al6a2
    complexed with 4st

Details for d2j0ma2

PDB Entry: 2j0m (more details), 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ma2 b.55.1.0 (A:254-359) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk
gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfi

SCOPe Domain Coordinates for d2j0ma2:

Click to download the PDB-style file with coordinates for d2j0ma2.
(The format of our PDB-style files is described here.)

Timeline for d2j0ma2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j0mb_