![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
![]() | Protein automated matches [254423] (5 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [254874] (2 PDB entries) |
![]() | Domain d2j0ma1: 2j0m A:131-253 [147845] Other proteins in same PDB: d2j0ma2, d2j0ma3, d2j0mb_ automated match to d2al6a1 complexed with 4st |
PDB Entry: 2j0m (more details), 2.8 Å
SCOPe Domain Sequences for d2j0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0ma1 a.11.2.0 (A:131-253) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv yrf
Timeline for d2j0ma1: