Lineage for d2j0ma1 (2j0m A:131-253)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697545Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2697546Protein automated matches [254423] (5 species)
    not a true protein
  7. 2697547Species Chicken (Gallus gallus) [TaxId:9031] [254874] (2 PDB entries)
  8. 2697549Domain d2j0ma1: 2j0m A:131-253 [147845]
    Other proteins in same PDB: d2j0ma2, d2j0ma3, d2j0mb_
    automated match to d2al6a1
    complexed with 4st

Details for d2j0ma1

PDB Entry: 2j0m (more details), 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ma1 a.11.2.0 (A:131-253) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf

SCOPe Domain Coordinates for d2j0ma1:

Click to download the PDB-style file with coordinates for d2j0ma1.
(The format of our PDB-style files is described here.)

Timeline for d2j0ma1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j0mb_