Lineage for d2j0ma3 (2j0m A:31-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540276Species Chicken (Gallus gallus) [TaxId:9031] [254873] (2 PDB entries)
  8. 2540277Domain d2j0ma3: 2j0m A:31-130 [147847]
    Other proteins in same PDB: d2j0ma1, d2j0ma2, d2j0mb_
    automated match to d2al6b3
    complexed with 4st

Details for d2j0ma3

PDB Entry: 2j0m (more details), 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0ma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ma3 d.15.1.0 (A:31-130) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
qseevhwlhldmgvsnvrekfelahppeewkyelrirylp

SCOPe Domain Coordinates for d2j0ma3:

Click to download the PDB-style file with coordinates for d2j0ma3.
(The format of our PDB-style files is described here.)

Timeline for d2j0ma3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j0mb_