Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [254873] (2 PDB entries) |
Domain d2j0ma3: 2j0m A:31-130 [147847] Other proteins in same PDB: d2j0ma1, d2j0ma2, d2j0mb_ automated match to d2al6b3 complexed with 4st |
PDB Entry: 2j0m (more details), 2.8 Å
SCOPe Domain Sequences for d2j0ma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0ma3 d.15.1.0 (A:31-130) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl qseevhwlhldmgvsnvrekfelahppeewkyelrirylp
Timeline for d2j0ma3: