Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.23: PFL3262-like [160018] (1 protein) Pfam PF07080; DUF1348 |
Protein Hypothetical protein PFL3262 [160019] (1 species) |
Species Pseudomonas fluorescens [TaxId:294] [160020] (1 PDB entry) Uniprot Q4KBL6 5-159 |
Domain d2imjd_: 2imj D: [147728] Other proteins in same PDB: d2imja2, d2imjb3, d2imjc3 automated match to d2imja1 complexed with act, edo |
PDB Entry: 2imj (more details), 1.5 Å
SCOPe Domain Sequences for d2imjd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2imjd_ d.17.4.23 (D:) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]} naqvrpplppftresaiekirlaedgwnsrdpervslaytldtqwrnraefahnreeaka fltrkwakeldyrlikelwaftdnriavryayewhddsgnwfrsygnenwefdeqglmar rfacindmpikaqerkfhwplgrrpddhpglse
Timeline for d2imjd_: