SCOPe 2.07: Domain d2imja1: 2imj A:5-159

Lineage for d2imja1 (2imj A:5-159)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.4: NTF2-like [54427] (31 families)
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.23: PFL3262-like [160018] (1 protein)
Pfam PF07080; DUF1348
Protein Hypothetical protein PFL3262 [160019] (1 species)
Species Pseudomonas fluorescens [TaxId:294] [160020] (1 PDB entry)
Uniprot Q4KBL6 5-159
Domain d2imja1: 2imj A:5-159 [147725]
Other proteins in same PDB: d2imja2, d2imjb3, d2imjc3
complexed with act, edo

Details for d2imja1

PDB Entry: 2imj (more details), 1.5 Å

PDB Description: x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.

PDB Compounds: (A:) Hypothetical protein DUF1348

SCOPe Domain Sequences for d2imja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imja1 d.17.4.23 (A:5-159) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]}
aqvrpplppftresaiekirlaedgwnsrdpervslaytldtqwrnraefahnreeakaf
ltrkwakeldyrlikelwaftdnriavryayewhddsgnwfrsygnenwefdeqglmarr
facindmpikaqerkfhwplgrrpddhpglselgl

SCOPe Domain Coordinates for d2imja1:

Click to download the PDB-style file with coordinates for d2imja1.
(The format of our PDB-style files is described here.)

Timeline for d2imja1: