SCOPe 2.07: Domain d2imjc2: 2imj C:5-158

Lineage for d2imjc2 (2imj C:5-158)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.23: PFL3262-like [160018] (1 protein)
   Pfam PF07080; DUF1348

6. Protein Hypothetical protein PFL3262 [160019] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [160020] (1 PDB entry)
   Uniprot Q4KBL6 5-159

8. Domain d2imjc2: 2imj C:5-158 [147727]
   Other proteins in same PDB: d2imja2, d2imjb3, d2imjc3
   automated match to d2imja1
   complexed with act, edo

Details for d2imjc2

PDB Entry: 2imj, 1.5 Å

PDB Description: x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14.

PDB Compounds: (C:) Hypothetical protein DUF1348

SCOPe Domain Sequences for d2imjc2:

Sequence; same for both SEQRES and ATOM records:

>d2imjc2 d.17.4.23 (C:5-158) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]}
aqvrpplppftresaiekirlaedgwnsrdpervslaytldtqwrnraefahnreeakaf
ltrkwakeldyrlikelwaftdnriavryayewhddsgnwfrsygnenwefdeqglmarr
facindmpikaqerkfhwplgrrpddhpglselg

Timeline for d2imjc2:

• d2imjc2 first appeared in SCOP 1.75, called d2imjc1
  
• d2imjc2 appears in SCOPe 2.06
  
• d2imjc2 appears in the current release, SCOPe 2.08