Class a: All alpha proteins [46456] (289 folds) |
Fold a.281: YheA-like [158621] (1 superfamily) 5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces |
Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) |
Family a.281.1.2: YheA-like [158626] (4 proteins) Pfam PF06133; DUF964 |
Protein Hypothetical protein SP1372 [158629] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [158630] (1 PDB entry) Uniprot Q97Q59 1-111 |
Domain d2iazc_: 2iaz C: [147595] Other proteins in same PDB: d2iaza2, d2iazb3, d2iazd3 automated match to d2iaza1 |
PDB Entry: 2iaz (more details), 2.4 Å
SCOPe Domain Sequences for d2iazc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iazc_ a.281.1.2 (C:) Hypothetical protein SP1372 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} sniydsanelsrglrglpeykavkaakdaiaadaeaskiftdylafqeeiqklaqtgqmp dasfqakmegfgkqiqgnsllsefftkqqqlaiylsdiekivfepvs
Timeline for d2iazc_: