SCOPe 2.07: Domain d2iazb2: 2iaz B:1-112

Lineage for d2iazb2 (2iaz B:1-112)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.281: YheA-like [158621] (1 superfamily)
   5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces

4. Superfamily a.281.1: YheA/YmcA-like [158622] (2 families)

5. Family a.281.1.2: YheA-like [158626] (4 proteins)
   Pfam PF06133; DUF964

6. Protein Hypothetical protein SP1372 [158629] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [158630] (1 PDB entry)
   Uniprot Q97Q59 1-111

8. Domain d2iazb2: 2iaz B:1-112 [147594]
   Other proteins in same PDB: d2iaza2, d2iazb3, d2iazd3
   automated match to d2iaza1

Details for d2iazb2

PDB Entry: 2iaz, 2.4 Å

PDB Description: Crystal structure of a Conserved Protein of Unknown Function SP1372 from Streptococcus pneumoniae

PDB Compounds: (B:) Hypothetical protein SP1372

SCOPe Domain Sequences for d2iazb2:

Sequence; same for both SEQRES and ATOM records:

>d2iazb2 a.281.1.2 (B:1-112) Hypothetical protein SP1372 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
msniydsanelsrglrglpeykavkaakdaiaadaeaskiftdylafqeeiqklaqtgqm
pdasfqakmegfgkqiqgnsllsefftkqqqlaiylsdiekivfepvsellk

Timeline for d2iazb2:

• d2iazb2 first appeared in SCOP 1.75, called d2iazb1
  
• d2iazb2 appears in SCOPe 2.06
  
• d2iazb2 appears in the current release, SCOPe 2.08