Lineage for d2iazc_ (2iaz C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739109Fold a.281: YheA-like [158621] (1 superfamily)
    5 helices; "kinked" antiparallel coiled coil; forms flexible oligomeric assemblies via two different dimerisation interfaces
  4. 2739110Superfamily a.281.1: YheA/YmcA-like [158622] (2 families) (S)
  5. 2739118Family a.281.1.2: YheA-like [158626] (4 proteins)
    Pfam PF06133; DUF964
  6. 2739119Protein Hypothetical protein SP1372 [158629] (1 species)
  7. 2739120Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [158630] (1 PDB entry)
    Uniprot Q97Q59 1-111
  8. 2739123Domain d2iazc_: 2iaz C: [147595]
    Other proteins in same PDB: d2iaza2, d2iazb3, d2iazd3
    automated match to d2iaza1

Details for d2iazc_

PDB Entry: 2iaz (more details), 2.4 Å

PDB Description: Crystal structure of a Conserved Protein of Unknown Function SP1372 from Streptococcus pneumoniae
PDB Compounds: (C:) Hypothetical protein SP1372

SCOPe Domain Sequences for d2iazc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iazc_ a.281.1.2 (C:) Hypothetical protein SP1372 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
sniydsanelsrglrglpeykavkaakdaiaadaeaskiftdylafqeeiqklaqtgqmp
dasfqakmegfgkqiqgnsllsefftkqqqlaiylsdiekivfepvs

SCOPe Domain Coordinates for d2iazc_:

Click to download the PDB-style file with coordinates for d2iazc_.
(The format of our PDB-style files is described here.)

Timeline for d2iazc_: