SCOPe 2.08: Domain d2i7pd1: 2i7p D:157-365

Lineage for d2i7pd1 (2i7p D:157-365)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.14: Fumble-like [159623] (6 proteins)
   Pfam PF03630; type II pantothenate kinase-like

6. Protein Pantothenate kinase 3, PANK3, C-terminal domain [419001] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [419473] (3 PDB entries)
   Uniprot Q9H999

8. Domain d2i7pd1: 2i7p D:157-365 [147557]
   Other proteins in same PDB: d2i7pa2, d2i7pa3, d2i7pb2, d2i7pb3, d2i7pc2, d2i7pc3, d2i7pd2
   automated match to d2i7pa1
   complexed with aco
   has additional insertions and/or extensions that are not grouped together

Details for d2i7pd1

PDB Entry: 2i7p, 2.05 Å

PDB Description: Crystal structure of human PANK3 in complex with AcCoA

PDB Compounds: (D:) Pantothenate kinase 3

SCOPe Domain Sequences for d2i7pd1:

Sequence; same for both SEQRES and ATOM records:

>d2i7pd1 c.55.1.14 (D:157-365) Pantothenate kinase 3, PANK3, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qaecyyfanasepercqkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslggg
tflglcslltgcesfeealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmi
ykekresvskedlaratlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllay
aldywskgqlkalflehegyfgavgallg

Timeline for d2i7pd1:

• d2i7pd1 first appeared in SCOP 1.75
  
• d2i7pd1 appears in SCOPe 2.07