![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.14: Fumble-like [159623] (6 proteins) Pfam PF03630; type II pantothenate kinase-like |
![]() | Protein Pantothenate kinase 3, PANK3, N-terminal domain [419000] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [419472] (3 PDB entries) Uniprot Q9H999 |
![]() | Domain d2i7pc2: 2i7p C:12-152 [147556] Other proteins in same PDB: d2i7pa1, d2i7pa3, d2i7pb1, d2i7pb3, d2i7pc1, d2i7pc3, d2i7pd1 automated match to d2i7pa2 complexed with aco |
PDB Entry: 2i7p (more details), 2.05 Å
SCOPe Domain Sequences for d2i7pc2:
Sequence, based on SEQRES records: (download)
>d2i7pc2 c.55.1.14 (C:12-152) Pantothenate kinase 3, PANK3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlelk dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl hlhkldeldclvkgllyidsv
>d2i7pc2 c.55.1.14 (C:12-152) Pantothenate kinase 3, PANK3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnrdvhlelkdltlfgrr gnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfgnlhlhkldeldcl vkgllyidsv
Timeline for d2i7pc2: