PDB entry 2i7p

View 2i7p on RCSB PDB site
Description: Crystal structure of human PANK3 in complex with AcCoA
Class: transferase
Keywords: PanK, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2006-08-31, released 2006-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.211
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (5-361)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d2i7pa1, d2i7pa2, d2i7pa3
  • Chain 'B':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (5-361)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d2i7pb1, d2i7pb2, d2i7pb3
  • Chain 'C':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (5-End)
      • cloning artifact (0-4)
    Domains in SCOPe 2.07: d2i7pc1, d2i7pc2, d2i7pc3
  • Chain 'D':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2i7pd1, d2i7pd2
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i7pA (A:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdv
    hlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfr
    tignlhlhkldeldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypll
    vvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqa
    dklvrdiyggdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvar
    mcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallgl
    pn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7pA (A:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsntgirdvhlelk
    dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl
    hlhkldeldclvkgllyidsvqaecyyfanasepercqkmpfnlddpypllvvnigsgvs
    ilavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyg
    gdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekin
    rvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2i7pB (B:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdv
    hlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfr
    tignlhlhkldeldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypll
    vvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqa
    dklvrdiyggdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvar
    mcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallgl
    pn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7pB (B:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsntgirdvhlelk
    dltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignl
    hlhkldeldclvkgllyidsvsqaecyyfanasepercqkmpfnlddpypllvvnigsgv
    silavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiy
    ggdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavneki
    nrvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglpn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2i7pC (C:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdv
    hlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfr
    tignlhlhkldeldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypll
    vvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqa
    dklvrdiyggdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvar
    mcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallgl
    pn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7pC (C:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnrdvhlelkdlt
    lfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfgnlhlhkld
    eldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgvsil
    avhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyggd
    yerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinrv
    vfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2i7pD (D:)
    vprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdv
    hlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfr
    tignlhlhkldeldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypll
    vvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqa
    dklvrdiyggdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvar
    mcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallgl
    pn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i7pD (D:)
    pwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsngirdvhlelkdltlfg
    rrgnlhfirfptqdlptfiqmgrdknfstlqtvlcatgggaykfekdfrtignlhlhkld
    eldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgvsil
    avhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyggd
    yerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinrv
    vfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallg