Lineage for d2i7pa1 (2i7p A:157-368)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884735Family c.55.1.14: Fumble-like [159623] (6 proteins)
    Pfam PF03630; type II pantothenate kinase-like
  6. 2884748Protein Pantothenate kinase 3, PANK3, C-terminal domain [419001] (1 species)
  7. 2884749Species Human (Homo sapiens) [TaxId:9606] [419473] (3 PDB entries)
    Uniprot Q9H999
  8. 2884750Domain d2i7pa1: 2i7p A:157-368 [147551]
    Other proteins in same PDB: d2i7pa2, d2i7pa3, d2i7pb2, d2i7pb3, d2i7pc2, d2i7pc3, d2i7pd2
    complexed with aco
    has additional insertions and/or extensions that are not grouped together

Details for d2i7pa1

PDB Entry: 2i7p (more details), 2.05 Å

PDB Description: Crystal structure of human PANK3 in complex with AcCoA
PDB Compounds: (A:) Pantothenate kinase 3

SCOPe Domain Sequences for d2i7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i7pa1 c.55.1.14 (A:157-368) Pantothenate kinase 3, PANK3, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qaecyyfanasepercqkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslggg
tflglcslltgcesfeealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmi
ykekresvskedlaratlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllay
aldywskgqlkalflehegyfgavgallglpn

SCOPe Domain Coordinates for d2i7pa1:

Click to download the PDB-style file with coordinates for d2i7pa1.
(The format of our PDB-style files is described here.)

Timeline for d2i7pa1: