Lineage for d2i76b1 (2i76 B:155-254)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334631Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2334632Protein automated matches [226851] (46 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:2336] [255232] (1 PDB entry)
  8. 2335090Domain d2i76b1: 2i76 B:155-254 [147537]
    Other proteins in same PDB: d2i76a1, d2i76a2, d2i76b2
    automated match to d2i76a1
    complexed with ndp

Details for d2i76b1

PDB Entry: 2i76 (more details), 3 Å

PDB Description: crystal structure of protein tm1727 from thermotoga maritima
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2i76b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i76b1 a.100.1.0 (B:155-254) automated matches {Thermotoga maritima [TaxId: 2336]}
kkayhlaaviasnfpvalaylskriytllgldepellihtlmkgvadnikkmrvecsltg
pvkrgdwqvveeerreyekifgntvlydeivkllrevaes

SCOPe Domain Coordinates for d2i76b1:

Click to download the PDB-style file with coordinates for d2i76b1.
(The format of our PDB-style files is described here.)

Timeline for d2i76b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i76b2