Class a: All alpha proteins [46456] (284 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.10: ProC C-terminal domain-like [116984] (2 proteins) similar dimer to the class I KARI |
Protein Hypothetical protein TM1727 [158734] (1 species) |
Species Thermotoga maritima [TaxId:2336] [158735] (1 PDB entry) Uniprot Q9X250 155-257 |
Domain d2i76b1: 2i76 B:155-254 [147537] Other proteins in same PDB: d2i76a2, d2i76b2 automatically matched to 2I76 A:155-257 complexed with ndp |
PDB Entry: 2i76 (more details), 3 Å
SCOP Domain Sequences for d2i76b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i76b1 a.100.1.10 (B:155-254) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} kkayhlaaviasnfpvalaylskriytllgldepellihtlmkgvadnikkmrvecsltg pvkrgdwqvveeerreyekifgntvlydeivkllrevaes
Timeline for d2i76b1: