![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Domain d2i76b1: 2i76 B:155-254 [147537] Other proteins in same PDB: d2i76a1, d2i76a2, d2i76b2 automated match to d2i76a1 complexed with ndp |
PDB Entry: 2i76 (more details), 3 Å
SCOPe Domain Sequences for d2i76b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i76b1 a.100.1.0 (B:155-254) automated matches {Thermotoga maritima [TaxId: 2336]} kkayhlaaviasnfpvalaylskriytllgldepellihtlmkgvadnikkmrvecsltg pvkrgdwqvveeerreyekifgntvlydeivkllrevaes
Timeline for d2i76b1: