Lineage for d2i0ka2 (2i0k A:58-273)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) 
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins) 
Protein Cholesterol oxidase [64414] (1 species) Species Brevibacterium sterolicum [TaxId:1702] [64415] (2 PDB entries) 
Domain d2i0ka2: 2i0k A:58-273 [147481]
Other proteins in same PDB: d2i0ka1
automatically matched to d1i19a2
complexed with cac, fad, gol, mn; mutant
Details for d2i0ka2
PDB Entry: 2i0k (more details), 1.6 Å
PDB Description: cholesterol oxidase from brevibacterium sterolicum- his121ala mutant
PDB Compounds: (A:) OxidoreductaseSCOP Domain Sequences for d2i0ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0ka2 d.145.1.1 (A:58-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
aplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdykirpr
gamagwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaivtelqk
hdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltavvwngt
tyaletyqrndpritplltnlgrcfltsvtmqagpn
SCOP Domain Coordinates for d2i0ka2:
Click to download the PDB-style file with coordinates for d2i0ka2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2i0ka2:
- d2i0ka2 is new in SCOP 1.75
- d2i0ka2 appears in SCOPe 2.01
- d2i0ka2 appears in the current release, SCOPe 2.08
View in 3D
