![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.0: automated matches [191624] (1 protein) not a true family |
![]() | Protein automated matches [191143] (13 species) not a true protein |
![]() | Species Brevibacterium sterolicum [TaxId:1702] [255227] (1 PDB entry) |
![]() | Domain d2i0ka2: 2i0k A:58-273 [147481] Other proteins in same PDB: d2i0ka1 automated match to d1i19a2 complexed with cac, fad, gol, mn; mutant |
PDB Entry: 2i0k (more details), 1.6 Å
SCOPe Domain Sequences for d2i0ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0ka2 d.145.1.0 (A:58-273) automated matches {Brevibacterium sterolicum [TaxId: 1702]} aplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdykirpr gamagwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaivtelqk hdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltavvwngt tyaletyqrndpritplltnlgrcfltsvtmqagpn
Timeline for d2i0ka2: