Lineage for d2i0ka2 (2i0k A:58-273)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987703Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2987704Protein automated matches [191143] (13 species)
    not a true protein
  7. 2987705Species Brevibacterium sterolicum [TaxId:1702] [255227] (1 PDB entry)
  8. 2987706Domain d2i0ka2: 2i0k A:58-273 [147481]
    Other proteins in same PDB: d2i0ka1
    automated match to d1i19a2
    complexed with cac, fad, gol, mn; mutant

Details for d2i0ka2

PDB Entry: 2i0k (more details), 1.6 Å

PDB Description: cholesterol oxidase from brevibacterium sterolicum- his121ala mutant
PDB Compounds: (A:) Oxidoreductase

SCOPe Domain Sequences for d2i0ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0ka2 d.145.1.0 (A:58-273) automated matches {Brevibacterium sterolicum [TaxId: 1702]}
aplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdykirpr
gamagwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaivtelqk
hdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltavvwngt
tyaletyqrndpritplltnlgrcfltsvtmqagpn

SCOPe Domain Coordinates for d2i0ka2:

Click to download the PDB-style file with coordinates for d2i0ka2.
(The format of our PDB-style files is described here.)

Timeline for d2i0ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i0ka1