Lineage for d2i0ka1 (2i0k A:274-613)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863760Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families) (S)
    duplication: contains two subdomains of this fold
  5. 863810Family d.58.32.3: Cholesterol oxidase [64284] (1 protein)
  6. 863811Protein Cholesterol oxidase [64285] (1 species)
  7. 863812Species Brevibacterium sterolicum [TaxId:1702] [64286] (2 PDB entries)
  8. 863813Domain d2i0ka1: 2i0k A:274-613 [147480]
    Other proteins in same PDB: d2i0ka2
    automatically matched to d1i19a1
    complexed with cac, fad, gol, mn; mutant

Details for d2i0ka1

PDB Entry: 2i0k (more details), 1.6 Å

PDB Description: cholesterol oxidase from brevibacterium sterolicum- his121ala mutant
PDB Compounds: (A:) Oxidoreductase

SCOP Domain Sequences for d2i0ka1:

Sequence, based on SEQRES records: (download)

>d2i0ka1 d.58.32.3 (A:274-613) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
frqrcqsytdipwrelfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvsptkp
dssnevgslgsagslvgkppqarevsgpynyifsdnlpepitdmigainagnpgiaplfg
pamyeitklglaatnandiwgwskdvqfyikattlrltegggavvtsraniatvindfte
wfheriefyrakgefplngpveirccgldqaadvkvpsvgpptisatrprpdhpdwdvai
wlnvlgvpgtpgmfefyremeqwmrshynnddatfrpewskgwafgpdpytdndivtnkm
ratyiegvpttenwdtararynqidphrvftngfmdkllp

Sequence, based on observed residues (ATOM records): (download)

>d2i0ka1 d.58.32.3 (A:274-613) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
frqrcqsytdipwrelfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvsgkpp
qarevsgpynyifsdnlpepitdmigainagnpgiaplfgpamyeitklglaatnandiw
gwskdvqfyikattlrltegggavvtsraniatvindftewfheriefyrakgefplngp
veirccgldqaadvkvpsvgpptisatrprpdhpdwdvaiwlnvlgvpgtpgmfefyrem
eqwmrshynnddatfrpewskgwafgpdpytdndivtnkmratyiegvpttenwdtarar
ynqidphrvftngfmdkllp

SCOP Domain Coordinates for d2i0ka1:

Click to download the PDB-style file with coordinates for d2i0ka1.
(The format of our PDB-style files is described here.)

Timeline for d2i0ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i0ka2