Lineage for d1i19a2 (1i19 A:57-273)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875232Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins)
  6. 875233Protein Cholesterol oxidase [64414] (1 species)
  7. 875234Species Brevibacterium sterolicum [TaxId:1702] [64415] (2 PDB entries)
  8. 875236Domain d1i19a2: 1i19 A:57-273 [61523]
    Other proteins in same PDB: d1i19a1, d1i19b1

Details for d1i19a2

PDB Entry: 1i19 (more details), 1.7 Å

PDB Description: crystal structure of cholesterol oxidase from b.sterolicum
PDB Compounds: (A:) cholesterol oxidase

SCOP Domain Sequences for d1i19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i19a2 d.145.1.1 (A:57-273) Cholesterol oxidase {Brevibacterium sterolicum [TaxId: 1702]}
vaplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdykirp
rgamhgwtpltvekganvekviladtmthlngitvntggpvatvtagagasieaivtelq
khdlgwanlpapgvlsiggalavnahgaalpavgqttlpghtygslsnlvteltavvwng
ttyaletyqrndpritplltnlgrcfltsvtmqagpn

SCOP Domain Coordinates for d1i19a2:

Click to download the PDB-style file with coordinates for d1i19a2.
(The format of our PDB-style files is described here.)

Timeline for d1i19a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i19a1