Lineage for d2htmf_ (2htm F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195492Superfamily d.15.3: MoaD/ThiS [54285] (5 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 1195511Family d.15.3.2: ThiS [54289] (4 proteins)
  6. 1195527Protein Uncharacterised protein TTHA0675 [159929] (1 species)
    probable ThiS homologue
  7. 1195528Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
    Uniprot Q5SKG8 1-63
  8. 1195532Domain d2htmf_: 2htm F: [147399]
    Other proteins in same PDB: d2htma_, d2htmb_, d2htmc_, d2htmd_
    automated match to d2cu3a1

Details for d2htmf_

PDB Entry: 2htm (more details), 2.3 Å

PDB Description: Crystal structure of TTHA0676 from Thermus thermophilus HB8
PDB Compounds: (F:) Putative thiamine biosynthesis protein ThiS

SCOPe Domain Sequences for d2htmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2htmf_ d.15.3.2 (F:) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqgg

SCOPe Domain Coordinates for d2htmf_:

Click to download the PDB-style file with coordinates for d2htmf_.
(The format of our PDB-style files is described here.)

Timeline for d2htmf_: