SCOP 1.75: Domain d2htmf1: 2htm F:1-63

Lineage for d2htmf1 (2htm F:1-63)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (4 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.2: ThiS [54289] (4 proteins)

6. Protein Uncharacterised protein TTHA0675 [159929] (1 species)
   probable ThiS homologue

7. Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
   Uniprot Q5SKG8 1-63

8. Domain d2htmf1: 2htm F:1-63 [147399]
   automatically matched to 2CU3 A:1-63

Details for d2htmf1

PDB Entry: 2htm, 2.3 Å

PDB Description: Crystal structure of TTHA0676 from Thermus thermophilus HB8

PDB Compounds: (F:) Putative thiamine biosynthesis protein ThiS

SCOP Domain Sequences for d2htmf1:

Sequence; same for both SEQRES and ATOM records:

>d2htmf1 d.15.3.2 (F:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqg

Timeline for d2htmf1:

• d2htmf1 is new in SCOP 1.75
  
• d2htmf1 is called d2htmf_ in SCOPe 2.01
  
• d2htmf1 appears in the current release, SCOPe 2.08, called d2htmf_