PDB entry 2htm

View 2htm on RCSB PDB site
Description: Crystal structure of TTHA0676 from Thermus thermophilus HB8
Class: biosynthetic protein
Keywords: thiamin biosynthesis, ThiG, Thermus thermophilus HB8, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-07-26, released 2007-01-26
The last revision prior to the SCOP 1.75 freeze date was dated 2007-01-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.253
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thiazole biosynthesis protein thiG
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG7 (0-End)
• Chain 'B':
  Compound: Thiazole biosynthesis protein thiG
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG7 (0-End)
• Chain 'C':
  Compound: Thiazole biosynthesis protein thiG
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG7 (0-End)
• Chain 'D':
  Compound: Thiazole biosynthesis protein thiG
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG7 (0-End)
• Chain 'E':
  Compound: Putative thiamine biosynthesis protein ThiS
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG8 (0-63)
    • modified residue (0)
    • modified residue (22)
    • modified residue (60)
  Domains in SCOP 1.75: d2htme1
• Chain 'F':
  Compound: Putative thiamine biosynthesis protein ThiS
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG8 (0-63)
    • modified residue (0)
    • modified residue (22)
    • modified residue (60)
  Domains in SCOP 1.75: d2htmf1
• Chain 'G':
  Compound: Putative thiamine biosynthesis protein ThiS
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG8 (0-63)
    • modified residue (0)
    • modified residue (22)
    • modified residue (60)
  Domains in SCOP 1.75: d2htmg1
• Chain 'H':
  Compound: Putative thiamine biosynthesis protein ThiS
  Species: Thermus thermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SKG8 (0-63)
    • modified residue (0)
    • modified residue (22)
    • modified residue (60)
  Domains in SCOP 1.75: d2htmh1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2htmE (E:)
  mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
  mqgg
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2htmF (F:)
  mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
  mqgg
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2htmG (G:)
  mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
  mqgg
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2htmH (H:)
  mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
  mqgg