SCOPe 2.08: Domain d2htmf_: 2htm F:

Lineage for d2htmf_ (2htm F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.2: ThiS [54289] (5 proteins)

6. Protein Uncharacterised protein TTHA0675 [159929] (1 species)
   probable ThiS homologue

7. Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries)
   Uniprot Q5SKG8 1-63

8. Domain d2htmf_: 2htm F: [147399]
   Other proteins in same PDB: d2htma_, d2htmb_, d2htmc_, d2htmd_
   automated match to d2cu3a1

Details for d2htmf_

PDB Entry: 2htm, 2.3 Å

PDB Description: Crystal structure of TTHA0676 from Thermus thermophilus HB8

PDB Compounds: (F:) Putative thiamine biosynthesis protein ThiS

SCOPe Domain Sequences for d2htmf_:

Sequence; same for both SEQRES and ATOM records:

>d2htmf_ d.15.3.2 (F:) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]}
mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval
mqgg

Timeline for d2htmf_:

• d2htmf_ first appeared in SCOP 1.75, called d2htmf1
  
• d2htmf_ appears in SCOPe 2.07