![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.31: ThiG-like [110399] (2 families) ![]() shares the common phosphate-binding site with other superfamilies |
![]() | Family c.1.31.0: automated matches [191453] (1 protein) not a true family |
![]() | Protein automated matches [190693] (3 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [187825] (1 PDB entry) |
![]() | Domain d2htmc_: 2htm C: [161455] Other proteins in same PDB: d2htme_, d2htmf_, d2htmg_, d2htmh_ automated match to d1xm3a_ |
PDB Entry: 2htm (more details), 2.3 Å
SCOPe Domain Sequences for d2htmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2htmc_ c.1.31.0 (C:) automated matches {Thermus thermophilus [TaxId: 274]} mdtwkvgpvelksrlilgsgkyedfgvmreaiaaakaevvtvsvrrvelkapghvgllea legvrllpntagartaeeavrlarlgrlltgerwvklevipdptyllpdpletlkaaerl ieedflvlpymgpdlvlakrlaalgtatvmplaapigsgwgvrtrallelfarekaslpp vvvdaglglpshaaevmelgldavlvntaiaeaqdppamaeafrlaveagrkaylagpmr p
Timeline for d2htmc_: