![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.3: MoaD/ThiS [54285] (4 families) ![]() possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.3.2: ThiS [54289] (4 proteins) |
![]() | Protein Uncharacterised protein TTHA0675 [159929] (1 species) probable ThiS homologue |
![]() | Species Thermus thermophilus [TaxId:274] [159930] (2 PDB entries) Uniprot Q5SKG8 1-63 |
![]() | Domain d2htmh1: 2htm H:1-63 [147401] automatically matched to 2CU3 A:1-63 |
PDB Entry: 2htm (more details), 2.3 Å
SCOP Domain Sequences for d2htmh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2htmh1 d.15.3.2 (H:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} mvwlngeprplegktlkevleemgvelkgvavllneeaflglevpdrplrdgdvvevval mqg
Timeline for d2htmh1: