Class b: All beta proteins [48724] (174 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.1: WW domain [51045] (1 family) |
Family b.72.1.1: WW domain [51046] (12 proteins) |
Protein Amyloid beta A4 precursor protein-binding family B member 1, APBB1 [159267] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159268] (4 PDB entries) Uniprot O00213 241-290! Uniprot O00213 253-285 |
Domain d2ho2a1: 2ho2 A:253-285 [147312] complexed with gol |
PDB Entry: 2ho2 (more details), 1.33 Å
SCOPe Domain Sequences for d2ho2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} sdlpagwmrvqdtsgtyywhiptgttqweppgr
Timeline for d2ho2a1: