PDB entry 2ho2

View 2ho2 on RCSB PDB site
Description: Structure of human FE65-WW domain in complex with hMena peptide.
Class: protein binding
Keywords: ww domain, beta sheet, fe65, protein binding
Deposited on 2006-07-13, released 2007-07-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: 0.174
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Amyloid beta A4 protein-binding family B member 1
  Species: Homo sapiens [TaxId:9606]
  Gene: APBB1, FE65
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00213 (1-End)
  Domains in SCOPe 2.01: d2ho2a1
• Chain 'B':
  Compound: Protein enabled homolog
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8N8S7 (0-9)
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ho2A (A:)
  gsdlpagwmrvqdtsgtyywhiptgttqweppgrasps
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ho2A (A:)
  sdlpagwmrvqdtsgtyywhiptgttqweppgr
  

  
  
• Chain 'B':
  No sequence available.