Lineage for d2ho2a1 (2ho2 A:253-285)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808661Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 808662Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 808663Family b.72.1.1: WW domain [51046] (12 proteins)
  6. 808664Protein Amyloid beta A4 precursor protein-binding family B member 1, APBB1 [159267] (1 species)
  7. 808665Species Human (Homo sapiens) [TaxId:9606] [159268] (4 PDB entries)
    Uniprot O00213 241-290! Uniprot O00213 253-285
  8. 808666Domain d2ho2a1: 2ho2 A:253-285 [147312]
    complexed with gol

Details for d2ho2a1

PDB Entry: 2ho2 (more details), 1.33 Å

PDB Description: structure of human fe65-ww domain in complex with hmena peptide.
PDB Compounds: (A:) Amyloid beta A4 protein-binding family B member 1

SCOP Domain Sequences for d2ho2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]}
sdlpagwmrvqdtsgtyywhiptgttqweppgr

SCOP Domain Coordinates for d2ho2a1:

Click to download the PDB-style file with coordinates for d2ho2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ho2a1: