Lineage for d2gz4a1 (2gz4 A:6-205)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736617Family a.211.1.1: HD domain [101340] (15 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2736641Protein Hypothetical protein Atu1052 [158725] (1 species)
  7. 2736642Species Agrobacterium tumefaciens [TaxId:358] [158726] (1 PDB entry)
    Uniprot Q8UGI5 6-205
  8. 2736643Domain d2gz4a1: 2gz4 A:6-205 [147196]

Details for d2gz4a1

PDB Entry: 2gz4 (more details), 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function ATU1052 from Agrobacterium tumefaciens
PDB Compounds: (A:) Hypothetical protein Atu1052

SCOPe Domain Sequences for d2gz4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gz4a1 a.211.1.1 (A:6-205) Hypothetical protein Atu1052 {Agrobacterium tumefaciens [TaxId: 358]}
sprawqrmlsgrrldlldpspldveiadiahglarvarwngqtrgdhaftvaqhclivet
ifcrmcpgatpdemqmallhdapeyvigdmispfksvvgggyktvekrleaavhlrfglp
phasrelkdrikkadtvaaffeatelagfstaeaqkffglprgitrdmfdiiplpsteaq
rlfiarfeaietlrvtrtgg

SCOPe Domain Coordinates for d2gz4a1:

Click to download the PDB-style file with coordinates for d2gz4a1.
(The format of our PDB-style files is described here.)

Timeline for d2gz4a1: