![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
![]() | Protein Hypothetical protein Atu1052 [158725] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [158726] (1 PDB entry) Uniprot Q8UGI5 6-205 |
![]() | Domain d2gz4d_: 2gz4 D: [147199] automated match to d2gz4a1 |
PDB Entry: 2gz4 (more details), 1.5 Å
SCOPe Domain Sequences for d2gz4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gz4d_ a.211.1.1 (D:) Hypothetical protein Atu1052 {Agrobacterium tumefaciens [TaxId: 358]} rawqrmlsgrrldlldpspldveiadiahglarvarwngqtrgdhaftvaqhclivetif crmcpgatpdemqmallhdapeyvigdmispfksvvgggyktvekrleaavhlrfglpph asrelkdrikkadtvaaffeatelagfstaeaqkffglprgitrdmfdiiplpsteaqrl fiarfeaietlrvtrtg
Timeline for d2gz4d_: