SCOPe 2.06: Domain d2gmoa1: 2gmo A:685-759

Lineage for d2gmoa1 (2gmo A:685-759)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
   alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet

4. Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family)
   automatically mapped to Pfam PF00604

5. Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins)
   C-terminal part of Pfam PF00604

6. Protein Polymerase basic protein 2, BP2 [160455] (1 species)

7. Species Influenza A virus [TaxId:11320] [160456] (4 PDB entries)
   Uniprot P31345 685-759

8. Domain d2gmoa1: 2gmo A:685-759 [147134]

Details for d2gmoa1

PDB Entry: 2gmo

PDB Description: nmr-structure of an independently folded c-terminal domain of influenza polymerase subunit pb2

PDB Compounds: (A:) Polymerase basic protein 2

SCOPe Domain Sequences for d2gmoa1:

Sequence; same for both SEQRES and ATOM records:

>d2gmoa1 d.361.1.1 (A:685-759) Polymerase basic protein 2, BP2 {Influenza A virus [TaxId: 11320]}
gvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssil
tdsqtatkrirmain

Timeline for d2gmoa1:

• d2gmoa1 first appeared in SCOP 1.75
  
• d2gmoa1 appears in SCOPe 2.05
  
• d2gmoa1 appears in SCOPe 2.07
  
• d2gmoa1 appears in the current release, SCOPe 2.08