Lineage for d2gmoa1 (2gmo A:685-759)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617351Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
    alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet
  4. 2617352Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family) (S)
    automatically mapped to Pfam PF00604
  5. 2617353Family d.361.1.1: PB2 C-terminal domain-like [160454] (2 proteins)
    C-terminal part of Pfam PF00604
  6. 2617354Protein Polymerase basic protein 2, BP2 [160455] (1 species)
  7. 2617355Species Influenza A virus, different strains [TaxId:11320] [160456] (4 PDB entries)
    Uniprot P31345 685-759
  8. 2617359Domain d2gmoa1: 2gmo A:685-759 [147134]

Details for d2gmoa1

PDB Entry: 2gmo (more details)

PDB Description: nmr-structure of an independently folded c-terminal domain of influenza polymerase subunit pb2
PDB Compounds: (A:) Polymerase basic protein 2

SCOPe Domain Sequences for d2gmoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmoa1 d.361.1.1 (A:685-759) Polymerase basic protein 2, BP2 {Influenza A virus, different strains [TaxId: 11320]}
gvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssil
tdsqtatkrirmain

SCOPe Domain Coordinates for d2gmoa1:

Click to download the PDB-style file with coordinates for d2gmoa1.
(The format of our PDB-style files is described here.)

Timeline for d2gmoa1: