Lineage for d2gmoa1 (2gmo A:685-759)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882957Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily)
    alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet
  4. 882958Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family) (S)
  5. 882959Family d.361.1.1: PB2 C-terminal domain-like [160454] (1 protein)
    C-terminal part of Pfam PF00604
  6. 882960Protein Polymerase basic protein 2, BP2 [160455] (1 species)
  7. 882961Species Influenza A virus [TaxId:11320] [160456] (2 PDB entries)
    Uniprot P31345 685-759
  8. 882964Domain d2gmoa1: 2gmo A:685-759 [147134]

Details for d2gmoa1

PDB Entry: 2gmo (more details)

PDB Description: nmr-structure of an independently folded c-terminal domain of influenza polymerase subunit pb2
PDB Compounds: (A:) Polymerase basic protein 2

SCOP Domain Sequences for d2gmoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmoa1 d.361.1.1 (A:685-759) Polymerase basic protein 2, BP2 {Influenza A virus [TaxId: 11320]}
gvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssil
tdsqtatkrirmain

SCOP Domain Coordinates for d2gmoa1:

Click to download the PDB-style file with coordinates for d2gmoa1.
(The format of our PDB-style files is described here.)

Timeline for d2gmoa1: