Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.361: PB2 C-terminal domain-like [160452] (1 superfamily) alpha-beta-alpha-X-alpha-beta(2); 3 layers, a/b/a; antiparallel beta-sheet, order 132; connection between helices 2 and 3 runs over the edge of the beta-sheet |
Superfamily d.361.1: PB2 C-terminal domain-like [160453] (1 family) |
Family d.361.1.1: PB2 C-terminal domain-like [160454] (1 protein) C-terminal part of Pfam PF00604 |
Protein Polymerase basic protein 2, BP2 [160455] (1 species) |
Species Influenza A virus [TaxId:11320] [160456] (2 PDB entries) Uniprot P31345 685-759 |
Domain d2gmoa1: 2gmo A:685-759 [147134] |
PDB Entry: 2gmo (more details)
SCOP Domain Sequences for d2gmoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmoa1 d.361.1.1 (A:685-759) Polymerase basic protein 2, BP2 {Influenza A virus [TaxId: 11320]} gvesavlrgflilgkedrrygpalsinelsnlakgekanvligqgdvvlvmkrkrdssil tdsqtatkrirmain
Timeline for d2gmoa1: