Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold ((64243)) beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold (64243)) |
Superfamily d.344.1: PriA/YqbF domain [160059] (4 families) associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2) |
Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein) N-terminal part of Pfam PF06425 |
Protein GINS complex subunit 3, PSF3 [160072] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries) Uniprot Q9BRX5 1-87 |
Domain d2ehol2: 2eho L:3-87 [146861] Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehod1, d2ehoe1, d2ehof1, d2ehog1, d2ehog2, d2ehoh1, d2ehoi1, d2ehoj1, d2ehok1, d2ehok2, d2ehol1 automatically matched to 2E9X C:1001-1087 complexed with so4 |
PDB Entry: 2eho (more details), 3 Å
SCOP Domain Sequences for d2ehol2:
Sequence, based on SEQRES records: (download)
>d2ehol2 d.344.1.4 (L:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnavpq gsklelplwlakglfdnkrrilsve
>d2ehol2 d.344.1.4 (L:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]} eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflnavpqgsklelplw lakglfdnkrrilsve
Timeline for d2ehol2: