SCOP 1.75: Domain d2ehoh2: 2eho H:3-87

Lineage for d2ehoh2 (2eho H:3-87)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold ((64243))
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold ((55657)) and the PsaD fold (64243))

4. Superfamily d.344.1: PriA/YqbF domain [160059] (4 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.4: PSF3 N-terminal domain-like [160071] (1 protein)
   N-terminal part of Pfam PF06425

6. Protein GINS complex subunit 3, PSF3 [160072] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160073] (3 PDB entries)
   Uniprot Q9BRX5 1-87

8. Domain d2ehoh2: 2eho H:3-87 [146855]
   Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehoc2, d2ehod1, d2ehoe1, d2ehof1, d2ehog1, d2ehog2, d2ehoh1, d2ehoi1, d2ehoj1, d2ehok1, d2ehok2, d2ehol1
   automatically matched to 2E9X C:1001-1087
   complexed with so4

Details for d2ehoh2

PDB Entry: 2eho, 3 Å

PDB Description: Crystal structure of human GINS complex

PDB Compounds: (H:) GINS complex subunit 3

SCOP Domain Sequences for d2ehoh2:

Sequence, based on SEQRES records:

>d2ehoh2 d.344.1.4 (H:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
eayfrvesgalgpeenflslddilmsheklpvrtetamprlgafflersagaetdnavpq
gsklelplwlakglfdnkrrilsve

Sequence, based on observed residues (ATOM records):

>d2ehoh2 d.344.1.4 (H:3-87) GINS complex subunit 3, PSF3 {Human (Homo sapiens) [TaxId: 9606]}
eayfrvesgalgpeenflslddilmsheklpvrtetamprlgaffldnavpqgsklelpl
wlakglfdnkrrilsve

Timeline for d2ehoh2:

• d2ehoh2 is new in SCOP 1.75
  
• d2ehoh2 appears in SCOPe 2.01
  
• d2ehoh2 appears in the current release, SCOPe 2.08