Lineage for d2ehob1 (2eho B:1-145)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781244Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
    5 helices, staggered bundle;
  4. 781245Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) (S)
    common to all subunits of the GINS complex
  5. 781246Family a.278.1.1: PSF1 N-terminal domain-like [158574] (1 protein)
  6. 781247Protein DNA replication complex GINS protein PSF1 [158575] (1 species)
  7. 781248Species Human (Homo sapiens) [TaxId:9606] [158576] (2 PDB entries)
    Uniprot Q14691 1-144! Uniprot Q14691 1-145
  8. 781251Domain d2ehob1: 2eho B:1-145 [146845]
    Other proteins in same PDB: d2ehoa1, d2ehoc1, d2ehoc2, d2ehod1, d2ehod2, d2ehoe1, d2ehog1, d2ehog2, d2ehoh1, d2ehoh2, d2ehoi1, d2ehok1, d2ehok2, d2ehol1, d2ehol2
    complexed with so4

Details for d2ehob1

PDB Entry: 2eho (more details), 3 Å

PDB Description: Crystal structure of human GINS complex
PDB Compounds: (B:) DNA replication complex GINS protein PSF1

SCOP Domain Sequences for d2ehob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehob1 a.278.1.1 (B:1-145) DNA replication complex GINS protein PSF1 {Human (Homo sapiens) [TaxId: 9606]}
mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip
tikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykrs
latymrslggdeglditqdmkppks

SCOP Domain Coordinates for d2ehob1:

Click to download the PDB-style file with coordinates for d2ehob1.
(The format of our PDB-style files is described here.)

Timeline for d2ehob1: