SCOPe 2.03: Domain d2ehoj1: 2eho J:1-145

Lineage for d2ehoj1 (2eho J:1-145)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.278: GINS helical bundle-like [158572] (1 superfamily)
   5 helices, staggered bundle;

4. Superfamily a.278.1: GINS helical bundle-like [158573] (4 families)
   common to all subunits of the GINS complex

5. Family a.278.1.1: PSF1 N-terminal domain-like [158574] (1 protein)

6. Protein DNA replication complex GINS protein PSF1 [158575] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158576] (2 PDB entries)
   Uniprot Q14691 1-144! Uniprot Q14691 1-145

8. Domain d2ehoj1: 2eho J:1-145 [146857]
   Other proteins in same PDB: d2ehoa1, d2ehoc1, d2ehoc2, d2ehod1, d2ehod2, d2ehoe1, d2ehog1, d2ehog2, d2ehoh1, d2ehoh2, d2ehoi1, d2ehok1, d2ehok2, d2ehol1, d2ehol2
   automatically matched to 2EHO B:1-145
   complexed with so4

Details for d2ehoj1

PDB Entry: 2eho, 3 Å

PDB Description: Crystal structure of human GINS complex

PDB Compounds: (J:) DNA replication complex GINS protein PSF1

SCOPe Domain Sequences for d2ehoj1:

Sequence; same for both SEQRES and ATOM records:

>d2ehoj1 a.278.1.1 (J:1-145) DNA replication complex GINS protein PSF1 {Human (Homo sapiens) [TaxId: 9606]}
mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip
tikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykrs
latymrslggdeglditqdmkppks

Timeline for d2ehoj1:

• d2ehoj1 first appeared in SCOP 1.75
  
• d2ehoj1 appears in SCOPe 2.02
  
• d2ehoj1 is called d2ehoj_ in SCOPe 2.04
  
• d2ehoj1 appears in the current release, SCOPe 2.08, called d2ehoj_