Class a: All alpha proteins [46456] (284 folds) |
Fold a.278: GINS helical bundle-like [158572] (1 superfamily) 5 helices, staggered bundle; |
Superfamily a.278.1: GINS helical bundle-like [158573] (4 families) common to all subunits of the GINS complex |
Family a.278.1.1: PSF1 N-terminal domain-like [158574] (1 protein) |
Protein DNA replication complex GINS protein PSF1 [158575] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158576] (2 PDB entries) Uniprot Q14691 1-144! Uniprot Q14691 1-145 |
Domain d2ehoj1: 2eho J:1-145 [146857] Other proteins in same PDB: d2ehoa1, d2ehoc1, d2ehoc2, d2ehod1, d2ehod2, d2ehoe1, d2ehog1, d2ehog2, d2ehoh1, d2ehoh2, d2ehoi1, d2ehok1, d2ehok2, d2ehol1, d2ehol2 automatically matched to 2EHO B:1-145 complexed with so4 |
PDB Entry: 2eho (more details), 3 Å
SCOPe Domain Sequences for d2ehoj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ehoj1 a.278.1.1 (J:1-145) DNA replication complex GINS protein PSF1 {Human (Homo sapiens) [TaxId: 9606]} mfcekamelirelhrapegqlpafnedglrqvleemkalyeqnqsdvneaksggrsdlip tikfrhcsllrnrrctvaylydrllriralrweygsilpnalrfhmaaeemewfnnykrs latymrslggdeglditqdmkppks
Timeline for d2ehoj1: