SCOPe 2.03: Domain d2ehog2: 2eho G:1-61

Lineage for d2ehog2 (2eho G:1-61)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.344: GINS/PriA/YqbF domain [160058] (1 superfamily)
   beta(4)-alpha-beta; 3-stranded antiparallel beta-sheet (strands 4,1 and 5) are covered on the same side by the helix and beta hairpin of strands 2 and 3; similarity to the L9 N-domain-like fold (55657) and the PsaD fold (64243)

4. Superfamily d.344.1: PriA/YqbF domain [160059] (4 families)
   associated with known or presumed DNA-binding domains; this superfamily also includes the C-terminal domain of PriA (PDB entry 1zt2)

5. Family d.344.1.2: PSF2 N-terminal domain-like [160065] (1 protein)
   N-terminal part of Pfam PF04128

6. Protein DNA replication complex GINS protein PSF2 [160066] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160067] (3 PDB entries)
   Uniprot Q9Y248 1-61

8. Domain d2ehog2: 2eho G:1-61 [146853]
   Other proteins in same PDB: d2ehoa1, d2ehob1, d2ehoc1, d2ehod1, d2ehod2, d2ehoe1, d2ehof1, d2ehog1, d2ehoh1, d2ehoh2, d2ehoi1, d2ehoj1, d2ehok1, d2ehol1, d2ehol2
   automatically matched to 2EHO C:1-61
   complexed with so4

Details for d2ehog2

PDB Entry: 2eho, 3 Å

PDB Description: Crystal structure of human GINS complex

PDB Compounds: (G:) DNA replication complex GINS protein PSF2

SCOPe Domain Sequences for d2ehog2:

Sequence; same for both SEQRES and ATOM records:

>d2ehog2 d.344.1.2 (G:1-61) DNA replication complex GINS protein PSF2 {Human (Homo sapiens) [TaxId: 9606]}
mdaaeveflaekelvtiipnfsldkiyliggdlgpfnpglpvevplwlainlkqrqkcrl
l

Timeline for d2ehog2:

• d2ehog2 first appeared in SCOP 1.75
  
• d2ehog2 appears in SCOPe 2.02
  
• d2ehog2 appears in SCOPe 2.04
  
• d2ehog2 appears in the current release, SCOPe 2.08